DPCstruct | MC29476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 55 ± 7 aa |
| Standard deviation of domain lengths | 7.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A166TXP1 | 3-47 | DTQCRNCSSFVTPQFARVFGNNRNEVYGCFECMTATEVKKGRAND |
| A0A161XS76 | 15-64 | DRRCRNCGSFVTPDFARVFGNNDDEVFGCLDCMSATAVKNGNARGESVGS |
| A0A1H6TDW0 | 1-60 | None |
| A0A6G3ZPT3 | 2-63 | None |
| L9YHP8 | 36-98 | None |
| A0A1D2QFY0 | 1-57 | None |
| A0A1I6IG94 | 1-47 | None |
| L9ZJC0 | 117-183 | None |
| L9Z3W7 | 58-101 | None |
| L0K4Q7 | 6-49 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.