DPCstruct | MC29475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 126 |
|---|---|
| Mean domain length (aa) | 268 ± 54 aa |
| Standard deviation of domain lengths | 54.07 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 20.21 |
| Pfam Score | 41.48 |
| Assigned Pfam label(s) | PF06405- PF05996- CL0063- PF01218 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0JNC7 | 2-164 | QVLDFAVFPESEYDLPIFCANFFSASKTNIVVLDLNPLYDVVENEDYKEKYYESLLPLGLKYAELLPWGGKLTGESLKFFSPIVIWT… |
| A0A1F7RWI5 | 6-247 | IYSEIRKTAVTEIEKIDGKKKWERNKWTPELGTFYISVFRGNAIEKASIARISLEVKRVVEGPGETLNITRLDGLQVNLFPSNPLLP… |
| A0A6A5DG18 | 70-325 | None |
| F6TJW1 | 223-564 | None |
| A0A7M5X625 | 36-227 | None |
| A0A1B0BJ76 | 378-715 | None |
| A0A381GIT0 | 2-190 | None |
| A0A4V1XWE7 | 260-569 | None |
| A0A244C329 | 4-231 | None |
| K8EZ24 | 178-461 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.