DPCstruct | MC29473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8059 |
|---|---|
| Mean domain length (aa) | 214 ± 54 aa |
| Standard deviation of domain lengths | 54.30 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 77.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 12.65 |
| Pfam Score | 47.51 |
| Assigned Pfam label(s) | PF02377- PF18701- PF00140- CL0003- PF12017 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381JB68 | 2-137 | FGINLSQGTMINFNDYCHENLKSVEENIKNSIINSQGAIHFDETGISIDKKRQWLHVASNNKYTYYEAHQERGKEAVDAINILSNFN… |
| E7H5G0 | 34-248 | NFTSPRQIPEDLREQIVDRFCKADVRDLSLTQAFYKLLDENKEYWCSLSTLYRLFRARGLNARRAPTREARRRSKPTAYSAEKPNEV… |
| A0A1Q9C203 | 242-442 | None |
| A0A6P8CKF4 | 20-150 | None |
| A0A081I5X0 | 14-220 | None |
| A0A7M5VBQ6 | 88-316 | None |
| A0A0D2P6W4 | 305-531 | None |
| A0A1Q9BQK3 | 4-221 | None |
| A0A1Q9C0Z7 | 513-707 | None |
| A0A1Q9BYI7 | 371-564 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.