DPCstruct | MC29472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 226 |
|---|---|
| Mean domain length (aa) | 172 ± 42 aa |
| Standard deviation of domain lengths | 42.05 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 92.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00384 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4MMG0 | 159-272 | CDLPPASPMTWGEQTDVPESADWYNSSYIIAWGSNVPQTRTPDAHFFTEVRYKGTKTVAITPDYAEIAKLCDLWLAPKQGTDAAMAL… |
| E7H456 | 45-243 | NSYSTAAISRILPYVVGTGDPRSTSWEMVLNHSERVILWGADPLVTNDIDWLTTLHNGAGYFRALKAKGTKTISINPIATDTAEYLG… |
| A0A251WNB8 | 1-118 | None |
| A0A7W1A4E4 | 78-237 | None |
| A0A5A9GGA0 | 140-245 | None |
| A0A377ZKW5 | 2-141 | None |
| A0A0B8P3V6 | 207-411 | None |
| A0A0B8PBX0 | 7-167 | None |
| A0A7C1IWD4 | 380-585 | None |
| A0A6G7Y7M6 | 82-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.