DPCstruct | MC29471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 410 ± 29 aa |
| Standard deviation of domain lengths | 28.95 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A418V607 | 10-436 | LLGLSLLAACGTNPAPTPKPTTPTDFSTLKTLSPGQQDTINTRLKVNVVFVGYRQTLPGQVPTARQIETADFQQTLPKTYNSIARIP… |
| A0A1S4BR46 | 1-447 | MVRITICFCIVIVALSLFTTQSEPAVQAYRRDPGHQQWHHGAFQDVKDSVRSDVRQMLHSRAEVPFQVPLEVNIVLVGFSGDGGYRY… |
| A0A1S3YBA9 | 4-404 | None |
| L1I7V0 | 37-490 | None |
| A0A7I4B6M7 | 7-448 | None |
| A0A4Y7L2W9 | 4-402 | None |
| A0A537H826 | 1-394 | None |
| A0A152A3M6 | 2-374 | None |
| A0A7J9QV09 | 501-869 | None |
| A0A519CI01 | 1-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.