DPCstruct | MC2947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 69 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 53.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03477 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7UQT4 | 7-62 | TYVVKRDGRSEDVHFDKITSRIQKLSYGLNMEFVDPVAVAIKVISGLYKGVTTVEL |
| A0A6H5KL69 | 1-70 | MFVIKRDGRKETVSFDKITARISHLCYGLDPTYVEPTLIAQKVISGVYPGVTTSELDELAAQTAAYQATQ |
| A0A5D3CUQ2 | 1-56 | None |
| A0A6A2WZS7 | 1-72 | None |
| A0A6C0I5G0 | 22-87 | None |
| A0A1I7U1Q0 | 149-223 | None |
| R9AMV3 | 4-83 | None |
| A0A2I0LF70 | 1-63 | None |
| A0A2J7ZQ87 | 2-71 | None |
| A0A0N5D713 | 12-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.