DPCstruct | MC29469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 114 ± 9 aa |
| Standard deviation of domain lengths | 9.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3BYX4 | 42-143 | EKVKKLDCRKFLTPGYTTSGHVELHTVSVERGMSWEEATHIWADQNGPDDGFYVQKQMRNNKKTAILVKEVNTSKRLFLVYRPNTGR… |
| A0A7R8WF20 | 245-356 | DKVTRVEKNVYESRHATGKAVTELHKVRVERGMSWQEAQEKYSTLLDDDEGFYVLKDGRNRMNRACAVLAVLRDPASLGKKKSPNAA… |
| A0A2I0TNK6 | 472-596 | None |
| A0A7R9KDN0 | 184-307 | None |
| A0A5K4F5D8 | 1173-1284 | None |
| A0A402E7F9 | 326-424 | None |
| A0A811X2H1 | 600-709 | None |
| A0A6J1PZ46 | 350-473 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.