DPCstruct | MC29468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Standard deviation of domain lengths | 5.85 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 72.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8RMR6 | 287-348 | HLRFEEDMVAFSCCIYDGGEEEKQEMDAAREKGWKGKFNRKGRIISPGGNRMDGKCPLTPLE |
| A0A287QVH1 | 20-81 | HLRFEEDMVAFSCCTYDGGRKEKIEMENARERSWRGKFHRPGRVINPEANRRDGKCPLTPLE |
| A0A804QD58 | 42-97 | None |
| A0A7J6VM23 | 1-70 | None |
| A0A287G6H4 | 187-253 | None |
| A0A164Y8K1 | 136-197 | None |
| A0A843WTJ3 | 507-568 | None |
| A0A804PFT7 | 41-97 | None |
| A0A7J8WPN8 | 95-164 | None |
| A0A6A1V0G0 | 319-383 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.