DPCstruct | MC29464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 6.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5FQS7 | 3-88 | ALQCALEGRNGIMASIQRTGSKPYRVIYSSVPIEKVANHEKKVPKEMIHENGCDITDKMIEYLLPLIQGEVNIRYEKGIPKHVNIK |
| A0A536U931 | 320-388 | AAVELALAGNNAVMPAIIRTSDKPYRWKIGVAPLDKIANVEKMLPRNYITADGFGITAKARAYLAPLIR |
| A0A386C7I0 | 1-76 | None |
| A0A847CAH0 | 2-87 | None |
| R5WGJ8 | 259-346 | None |
| A0A382FF51 | 13-102 | None |
| D4IYH5 | 1-75 | None |
| A0A6L5DK17 | 505-587 | None |
| A0A3D4HZ13 | 42-122 | None |
| A0A849DV82 | 60-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.