DPCstruct | MC2946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 7.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9LGN3 | 124-195 | GVVAYDVTEPRRPALVDYLSTRDFAGSVEDGTAGDVGPEGVFFVSAGDSPTRRPLLIVGNEVSGTTAIYEIR |
| A0A6H5KAZ9 | 1-74 | MYAFVSLERIGGWMCWDASDATAPVFQSYVNSYEEDTAPESGAILPAEYSPTENALLLGAFEESNTLAIFELVV |
| A0A6N3UFN0 | 237-314 | None |
| A0A1H9NS77 | 1-63 | None |
| A0A1I1R078 | 14-83 | None |
| W4QD95 | 323-394 | None |
| A0A379Z634 | 95-177 | None |
| A0A2S9XBI9 | 405-488 | None |
| A0A376CJC4 | 277-358 | None |
| A0A1W1UYS0 | 233-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.