DPCstruct | MC29454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 111 ± 18 aa |
| Standard deviation of domain lengths | 18.16 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.55 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0318- PF11845 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831SSP8 | 3-86 | CHSMAPPPVAAPPVRGVSFHYREAFESREDAVEHMVAFMKNPDPEQAVCDPQAIERFGLMPAMQLAEDELRTVSGWFWDQYDPS |
| A0A2G2CM16 | 6-106 | AEQIFDAKCAMCHTKTMPTDRANMFAPPLMGVMRHVKMAYPNKEDAVNFMVDYVQNPTKEKSICMPQKIAKFGLMPSQKGNITPEEL… |
| A0A317ZEB5 | 13-117 | None |
| A0A7V2T2Q0 | 21-138 | None |
| A0A317T4Y5 | 3-80 | None |
| A0A2H3KK27 | 18-116 | None |
| A0A6M0LMM7 | 148-261 | None |
| A0A6M0LN09 | 44-156 | None |
| A0A7V5BC05 | 5-114 | None |
| A0A5C2H8L9 | 4-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.