DPCstruct | MC2945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 203 ± 41 aa |
| Standard deviation of domain lengths | 41.14 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5K9Q0 | 3-252 | MSAAKGTPEPGPAWLVEERDACGVGFIANPKPEHKVVELGLAALGCMEHRGACLADNVSGDGSGIMTSVPWALLEREYSDMGVETDS… |
| A0A7U9RWB6 | 2-167 | SGELITDSMKPMHDRSNGLGGGFAGYGIYPEYKEFYAFHMFFDTRDTRKECEAFLKERFEIIQSERIPTRRIPAITDEPIIWRYFIA… |
| A0A2X2E8K5 | 1-187 | None |
| A0A0G4KM02 | 15-263 | None |
| C4KHJ1 | 1-222 | None |
| A0A811EBX1 | 8-238 | None |
| A0A0R3T9F8 | 2-213 | None |
| A0A536S0N2 | 11-241 | None |
| A0A5E4PR16 | 10-184 | None |
| A0A840TD97 | 8-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.