DPCstruct | MC29448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 8.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0IB59 | 1-71 | MKDWLKANAQASDYALIQGNFGLAFILVNFCRAIGLIPVYSTTERQSVEVKQADGSVITQRIFKHKLFRKY |
| U2UNB5 | 45-122 | EQVDALAAAYAARILDREPAAVLCQGESCYVFSLVTRLKAAGIPVLAACSERRVREREDEAGNIIRESQFCFVQFRGY |
| A0A7X8QFA0 | 12-96 | None |
| A0A7Y8HM89 | 10-85 | None |
| A0A562RIJ5 | 76-161 | None |
| A0A8B2DG47 | 623-704 | None |
| A0A7C1DMH8 | 4-80 | None |
| A0A7C3RLR5 | 200-278 | None |
| A0A7V3ULT9 | 4-62 | None |
| A0A6N2E0X4 | 43-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.