DPCstruct | MC29444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 115 ± 10 aa |
| Standard deviation of domain lengths | 9.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G2E8R2 | 34-158 | MRKPELRFYRHVLEMTKSEPEETIFVDDKSENILAARSLGITGIQFNGTTKFFGQILNLVGNPIQRGQDYLSSQGRKPHSLSNTGHA… |
| B6QD31 | 1-128 | MCRPELRFYKYLLDSPRTQSCQAIFVERNKENTLAALSLGAHGIVCNSHETLERGLLSVVGDQIERRFAFLTKSLKKMHSVTNNGLI… |
| A0A3D8T696 | 147-264 | None |
| A0A384JPX5 | 84-193 | None |
| A0A2C5XT65 | 45-142 | None |
| A0A094GAB1 | 2-122 | None |
| A0A1L9VTF4 | 1-124 | None |
| A0A409XAR8 | 32-140 | None |
| A0A447C250 | 130-255 | None |
| A0A5N6FNB5 | 7-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.