DPCstruct | MC29431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 184 ± 23 aa |
| Standard deviation of domain lengths | 23.29 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 19.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05267 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4HZB0 | 9-143 | ECVDYYSPLLKGHVDKYNEDFTTCKDNYDRAFFLIDSSYRSSRDELSVSVRDTCQSLLTCNGKTSNSDAFDCLASGGPLASKELEKT… |
| A0A6P8YAA5 | 16-196 | QAASSKVDPDVSFMQYMMKSSGLIQASSTSTECFGIYLPKLQAIAEQWQADTIACEDTAEEAREQIDDKTKDNRTAIDASATGACAA… |
| A0A3B0J323 | 9-202 | None |
| A0A1L8EA84 | 17-171 | None |
| B4GBD0 | 15-197 | None |
| A0A811VLN3 | 25-203 | None |
| A0A1A9Z590 | 37-251 | None |
| A0A1I8N217 | 14-183 | None |
| A0A6J2UJK2 | 2-151 | None |
| B4GBC9 | 4-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.