DPCstruct | MC2943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 211 ± 26 aa |
| Standard deviation of domain lengths | 26.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 22.74 |
| Pfam Score | 98.48 |
| Assigned Pfam label(s) | CL0484- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8U4W9 | 25-241 | NETNPFTPSKDPTVTHFHSLFYDTFTWKYPRTTGLLFASSLAFFLLGHYVNILRYAFKAAYITFAATAAIEYLGRPTTGTGFMTQVR… |
| A0A091CLW4 | 26-217 | ILRFSIYITIDLLYWRDIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKAYLELEITL… |
| C5DQB0 | 39-245 | None |
| K9IYR1 | 1-199 | None |
| A0A0R3U2H1 | 22-226 | None |
| D3AZK0 | 95-292 | None |
| A0A218WKK7 | 1-216 | None |
| A0A7S1TEX6 | 6-197 | None |
| Q0JPF1 | 1-178 | None |
| A0A7M7GTH7 | 7-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.