DPCstruct | MC29426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 109 ± 10 aa |
| Standard deviation of domain lengths | 9.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7UVB2 | 1-102 | MYPVPLLSTPLSSNLTGALPLSVLQGRVRSGFLTVNETRRLVLLLGSDSHVCTVPLIGIWISDVSISHPLVWSMLLHFSHFPSLHKV… |
| A0A6J3AZQ2 | 204-309 | VKPIPIIPTALARNLSSNLSISQVQGTYKYGYLTMDETRKLLLLLESDPKVYSLPLVGIWLSGIIHIYSPQVWACCLRYMFSSSIQE… |
| A0A3P9LLE7 | 8-106 | None |
| S4RI50 | 222-321 | None |
| A0A820F2A2 | 382-501 | None |
| A0A0D2MR05 | 164-267 | None |
| A0A6G0M3C9 | 274-404 | None |
| A0A3P9MVP8 | 180-290 | None |
| A0A2P6V6X0 | 241-350 | None |
| A0A7J7K1V5 | 175-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.