DPCstruct | MC29423
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Standard deviation of domain lengths | 7.90 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3SWF8 | 87-155 | EDMVDPWNVSTTNAKGVDYDKLIVRFGSSKIDQELVDRIERVSGQKAHRFLRRGIFFSHRDMHQVLDAY |
| A0A1X7URX2 | 4-70 | ESAQPKEQIVDPWTAKAGEGEKKINYDKLIVQFGSERIDESLLQRIETLSKKPAHHFLRRGIFFSHR |
| A0A4U5MNN9 | 46-126 | None |
| A0A812U2E6 | 272-348 | None |
| U6M0I2 | 214-278 | None |
| A0A182EJZ3 | 2-70 | None |
| A0A7D9DBL1 | 473-542 | None |
| A0A5E4AQD0 | 172-244 | None |
| A0A7R8H9F2 | 13-86 | None |
| A0A2H2IAK5 | 16-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.