DPCstruct | MC29421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 179 ± 23 aa |
| Standard deviation of domain lengths | 23.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.91 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0123- CL0063- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A068Y7I0 | 62-200 | NFRAKPYKPVTLEESIQYLSSPEYQELYRGKPVWFYFRRNYKGHFPPKYPRKSCTRAHKLITSNPCPICRDEYLVIDHKNVGLLKQF… |
| A0A1X7UR86 | 1-181 | MYKLFQSISSCQRLNSLPPSILNCRLVPLSTSGPLCKGLPPRPRLPGFGYNRSQMVYKQHKQFKFIFDGEDRVKNIWEDYQRNHKGS… |
| A0A3P7JAG5 | 23-192 | None |
| A0A7J7IZJ0 | 37-211 | None |
| A0A1U7SWY4 | 3-197 | None |
| A0A819QE52 | 2-208 | None |
| A0A498MGC4 | 2-170 | None |
| A0A485NG82 | 85-274 | None |
| A0A7R8X3Z8 | 3-166 | None |
| A0A3Q4I9G1 | 6-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.