DPCstruct | MC2942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 96 ± 3 aa |
| Standard deviation of domain lengths | 3.13 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 86.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E0P214 | 60-149 | GKGISRVISDLVRTGSADELLRVRGLVPAELPKLLRVRGLGPARVRALWRQAGVESPQDLRKAATDGRVQALRGFGAKTVERILAGL… |
| A0A2V8M1L9 | 1-103 | MVDQDGVAGLQEIPGVGKAIAGKIVELLEQGTFDAWEKLTAETPETVLDLLELPGVGPKTAAMLHQKFKIASLDELRKFAKGGGLEM… |
| A0A7W0TUJ7 | 49-145 | None |
| A0A101IMP1 | 225-321 | None |
| A0A0G1AAD7 | 51-146 | None |
| A0A5N9VY19 | 1-99 | None |
| A0A1F4XKP4 | 55-148 | None |
| A0A518K674 | 52-147 | None |
| A0A7X3RC16 | 158-250 | None |
| A0A2D6J0E1 | 48-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.