DPCstruct | MC29417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 6.96 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 50.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19718 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7UIM3 | 35-108 | AELSGVTVDAISVATYLRSFPAEISRLDIANELQWNQASLYDADGDVIYYKDNREELKITTEDREEIKMTESKR |
| A0A1S3W9P5 | 42-128 | CEISGIPLEDLEFAKGKGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKT |
| A0A8B6CCG1 | 406-492 | None |
| A0A5N5T9J2 | 792-884 | None |
| S9WEA1 | 611-691 | None |
| A0A1X7T663 | 540-626 | None |
| A0A1X7T4P1 | 2-83 | None |
| A0A1X7SXH4 | 116-199 | None |
| A0A1X7ST37 | 182-271 | None |
| A0A1X7SPG1 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.