DPCstruct | MC29416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 113 ± 7 aa |
| Standard deviation of domain lengths | 7.00 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 29.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06918 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7BT47 | 288-401 | AHEIKRLPKRSRVNISKVAELKVIVPTPLAISMKESLGLSWRQERKHKAYLKQVGVEMPHERSERQCAKDVTRDWVHVDMKVFEGPD… |
| A0A1X7UE06 | 4-117 | EIKRLPAEEREELMKAADFTITVPAEQGLALKSDLCLHWRKVRIMRRWMKSWGLSIASEQKQRRALKTMLMEMEIQGESIPFSFRTR… |
| A0A7M7N2J8 | 361-473 | None |
| A0A3M6U5V9 | 7-102 | None |
| A0A6P4XIW0 | 82-201 | None |
| A0A6P8J0M4 | 2-110 | None |
| A0A1X7SYS9 | 9-111 | None |
| C3ZUQ6 | 18-129 | None |
| A7S6Q9 | 7-119 | None |
| A0A6P4ZP96 | 61-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.