DPCstruct | MC29415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 122 ± 12 aa |
| Standard deviation of domain lengths | 12.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 77.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7SN37 | 251-367 | MMSCEEGYSDNMVSLRRDVIGEVMSVYKESCPSLEVKELVIDPKELAYPVNTPRERTTYGIYNVLLAIKKRKPFLVSNKGQTKLKEI… |
| A0A1X7UDS3 | 1-113 | MSFKQHIMMSVGRDVIGEVMSVYKESCPSLEVEELVIDPKELAYPVNTPRERTVYSVKDILSAIGNGGNCLVHRNGTSTELKEILPD… |
| A0A1X7T2P8 | 136-244 | None |
| A0A1X7ST20 | 45-165 | None |
| A0A1X7SSX5 | 135-249 | None |
| A0A1X7SI31 | 1-145 | None |
| A0A1X7TWV2 | 863-972 | None |
| A0A1X7TPL0 | 31-151 | None |
| A0A1X7UWF4 | 132-276 | None |
| A0A1X7SEK1 | 202-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.