DPCstruct | MC29414
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 107 ± 25 aa |
| Standard deviation of domain lengths | 25.04 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 61.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7U6S9 | 884-1029 | PTSCNEIKQEQLHSPSGVYLLKTSSSYYTAYCNMEELCGSGGGWTRLAYLDMTDSTVNCPSGFRLYQSGGVRACGRPVTSSGSCVSV… |
| A0A1X7UD56 | 182-276 | SPSGWYNLNNQNTYCNMEELCGSGGGWTRLAYLDMTDATQNCPSGFRLYQSGGVRACGRTNSSGGSCVSVQFPSNGISYSQICGRVT… |
| A0A1X7TMD2 | 574-681 | None |
| A0A1X7TD09 | 201-281 | None |
| A0A1X7TFJ7 | 2-93 | None |
| A0A1X7TFL8 | 1-70 | None |
| A0A1X7TGF5 | 20-131 | None |
| A0A1X7TJ08 | 130-237 | None |
| A0A1X7TJD5 | 58-163 | None |
| A0A1X7TM41 | 122-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.