DPCstruct | MC29412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 350 ± 49 aa |
| Standard deviation of domain lengths | 49.01 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10156 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9XV02 | 126-427 | IFTALIRGAGNLPTTTARVSERLIVIEIAQGTELYLELVESDTLPSPSQPAVHSIGQTKCDMIYHLLHILLLRLHSHIKERRLSTSN… |
| A0A1X7UA70 | 11-357 | SAQNVLFNEELFAQLAKEAFDQRSSLQGEVLTDRINIPLTTKVWLSVLLVREYDRDKKNDKAPPPDSLPSPNWELTVSFKQLLRANH… |
| A0A1I8C308 | 334-677 | None |
| A0A1Y2GFN2 | 205-647 | None |
| A0A811P4D0 | 266-652 | None |
| A0A0G4LYS3 | 524-951 | None |
| A0A3M7MAV7 | 302-696 | None |
| A0A1D1W6Z2 | 296-668 | None |
| A0A182F5C8 | 567-921 | None |
| L8YAU8 | 123-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.