DPCstruct | MC29411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 6.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 55.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7U8N5 | 1-64 | KVIYSAYIDGISLTHGNPRKHIWSLISGNSDVAISKCPCASNNLKSVPAFIGFHYYCESGCHNS |
| A0A1X7ULT6 | 96-165 | ATNNHNNINGDYVDGISITRGSPRQHVWTLIATGVDTLFKGGIYNCPCTNGSTQVTQSFVGSHYFCEGAG |
| A0A1X7TZS3 | 10-82 | None |
| A0A1X7SXL1 | 1-83 | None |
| A0A1X7TM21 | 48-116 | None |
| A0A1X7USW5 | 323-400 | None |
| A0A1X7TJ08 | 238-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.