DPCstruct | MC29410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 146 ± 28 aa |
| Standard deviation of domain lengths | 27.50 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11075 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S9MNJ1 | 8-133 | LLPLLTQTLGISTTQATGGMGALLQTAQSLLSGGDFSVIANAIPGVSDLLGAAPDVSGSANSSLLGSAMSMVGDASPSLKAGAELVS… |
| A0A347UT68 | 74-187 | ELEHQNPIADMVGEKLSISTDMAASGSSAMLALAENQLKGDNLSELNKLVPGLSDLTDISLTMGSIDSLDKVKSAFSKSGMDASQIA… |
| W5ILT8 | 2-121 | None |
| A0A090PA52 | 1-138 | None |
| A0A1G8JB74 | 1-183 | None |
| A0A2P5LFW7 | 55-233 | None |
| A0A368NLJ9 | 1-155 | None |
| A0A0M1JJ96 | 52-204 | None |
| A0A5E6T3G1 | 113-295 | None |
| A0A2S7W7W8 | 13-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.