DPCstruct | MC2941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 149 ± 29 aa |
| Standard deviation of domain lengths | 28.60 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4LXF7 | 190-288 | PMRVAIPDRTAQAFDIRVKAAQIARDRGQPQHVNNGEECDYPFVANYSKGLRHDSLGDVDPASYQSLLHALNTRNPADFEAIILGPG… |
| A0A2V8LTW8 | 1-147 | MNRNNSRPSGRREFLAQVGLAAMAASGALGVSSGRLAAEELGPINAHQRAEKAYNLRHDAALFQRHLPLPSHAINGDDRRYHDFIGS… |
| A5EER7 | 9-172 | None |
| A0A6C0D019 | 1-123 | None |
| A0A433VW62 | 32-174 | None |
| A0A522TDW4 | 1-154 | None |
| A0A2V9ZXU7 | 1-183 | None |
| A0A7W1SX17 | 1-147 | None |
| A0A2V8P1W8 | 3-183 | None |
| A0A7Y9NP90 | 1-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.