DPCstruct | MC29404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 4.67 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 76.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3ENM3 | 971-1049 | MRDAGNSWAEIAKTFPTRTEGSVKKHWYKDMHYAEFAEDESQALLNAIKEYENNKWKVIGQKVGKPAKACEQYAKEHFP |
| A0A6A6WYE4 | 1-79 | MRDAGNSWSEIAKTFPQRTEGSVKKHWYKDMHYAEFGEDESAALLAAIKEYDSNKWKVIGQKVGKPAKACEQFAKENFG |
| A0A2T3A049 | 192-279 | None |
| A0A0J9XEW2 | 387-463 | None |
| A0A4U0XTH2 | 197-272 | None |
| A0A6G1I8C0 | 25-106 | None |
| A0A0G2F683 | 1-79 | None |
| G0SFX6 | 377-448 | None |
| A0A6H0XVM0 | 366-449 | None |
| A0A139IPB2 | 738-816 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.