DPCstruct | MC29401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 189 ± 31 aa |
| Standard deviation of domain lengths | 31.02 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 22.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812XAU7 | 11-158 | ENGDIPRTAEGRPDFNGIWQAINTAHYDIEPHAADFSPVVEMGAIGAIPAGLGIVEGGEIPYTAEARAKQQENKSDWLANDPLVKCY… |
| A0A2V8PCT3 | 4-205 | FINAAFWIAVFATNAPSLLAQWPPYPTPGVPRLPNGQPNLEAPAPRTLDGKPDLSGIWQIVRPPADQTPASFLGGGGTANAARPATP… |
| A0A2E4FRA3 | 156-366 | None |
| A0A2E4FNZ5 | 1-171 | None |
| A0A2V8K7T6 | 127-310 | None |
| A0A2V8K7S8 | 1-173 | None |
| A0A2V8JFA6 | 1-185 | None |
| A0A7W6CLQ0 | 5-206 | None |
| A0A258GXA9 | 1-200 | None |
| A0A812IRD0 | 463-652 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.