DPCstruct | MC294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 133 ± 17 aa |
| Standard deviation of domain lengths | 16.56 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19560 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G2G5J3 | 31-168 | LRRLELAERASRRRALAHQQRMHWELLSRAIDNPALAAVIDTYDPGIPAERRRQYFYANAWYINLYHLHRTGILNQEEFYGHARELF… |
| A0A6N9XKD2 | 19-150 | AGVALSLLMQRKQTRISQVQASRTMRLELVKPALDDPELLAAWGYREETPAAEARLRAYTNLVFAYLLTAFDLGTITEPELRSEMKR… |
| A0A7Y0JU98 | 85-212 | None |
| A0A6G4VG59 | 99-247 | None |
| A0A197SKE2 | 8-132 | None |
| A0A7K3S144 | 3-150 | None |
| K4R1I4 | 3-116 | None |
| A0A3D9JHN2 | 2-106 | None |
| A0A1G9AX93 | 41-173 | None |
| A0A1V0VEB3 | 7-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.