DPCstruct | MC29399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 101 ± 9 aa |
| Standard deviation of domain lengths | 8.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 33.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351X3V2 | 1-82 | MDPTFDEFKEIFKRVAEQKGVKYNDAGVNYLLQDFYIKGNHKLRANHPRDLCDQIVDISHYLGKEAETTPELIDRAVQSYFV |
| A0A2V8P6C2 | 51-147 | VDDAFLRRIGYRSYVTPPRREMYAEIFKNYVESTGFLSETGLIDFVLRCYEHEQRPLRGCEPRDLVQRCIDMCDYESRQRVVTRELI… |
| A0A357C590 | 1-96 | None |
| A0A838GV38 | 1-97 | None |
| A0A2V8BKM8 | 677-774 | None |
| A0A521XC40 | 50-158 | None |
| A0A534Q3I1 | 19-117 | None |
| A0A5C6CCY1 | 469-565 | None |
| A0A3L7S8E3 | 468-578 | None |
| A0A7V9BJ87 | 82-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.