DPCstruct | MC29397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 238 ± 25 aa |
| Standard deviation of domain lengths | 24.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W5FRH1 | 624-853 | APISPYIYGANEDMTGTENFTARRMGGNRMSTYNWENNASNSGSDWIHHNDGFVPWYYGNIPEAQWKVPGIAAIGFHEQSLKKGAYS… |
| A0A2V8NTE3 | 1-251 | MNCGACFRSSILTLVLCATALAQNPTATITVDVNASRRPIDPRIYGIAFGSTAQLSDLNVPLNRYGGNNSSRYNWQSNADNRGLDWY… |
| A0A2V7WDA6 | 34-268 | None |
| D2VUH6 | 47-275 | None |
| A0A4P5ZF06 | 613-822 | None |
| A0A5C3LAJ6 | 273-470 | None |
| A0A7C6EJI2 | 1-237 | None |
| A0A3B0CMC4 | 326-544 | None |
| A0A7Y7N7U2 | 178-412 | None |
| W6S145 | 1-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.