DPCstruct | MC29396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 181 ± 34 aa |
| Standard deviation of domain lengths | 34.35 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8NSS7 | 2-187 | EPFRTFSFRTEKGKPFVASARRKCRFLYFYFINRDFGLMPVKLQTRFPMPIQVYVNGHEWLARKLKQHAIRYTKRENAFLWIEDLAR… |
| A0A4R6EVE1 | 107-325 | HVISAMEACPSYKPWHDKSSGKTYLRPETGKCLHYYFYFIDDELGLCYLRVPTWAPFGLQFYCNGHGAVARALKREGIGFVQADNAF… |
| F4LXC3 | 378-536 | None |
| A0A7Y5SGM3 | 2-175 | None |
| A0A2G6MTA3 | 9-167 | None |
| A0A521UD49 | 1-146 | None |
| I0WZH2 | 130-361 | None |
| A0A498QK12 | 7-180 | None |
| A0A081HXW5 | 113-336 | None |
| A0A521V0Z7 | 18-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.