DPCstruct | MC2939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 5.59 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8ZY84 | 68-148 | EQALRDYRQVKNATTRGDVVKYFVPDGGLQFPAKTRYVHPRCEYLHVDVEFELVKPSEIASLPDDKVIGVSKLYVEYPAKD |
| A0A2V8LKG8 | 16-97 | ARSLSEIQTVKVGMKRRDLLRLFTTEGGFSSRTSRKYVYKGSPYIKVDIQFQPAGATGNPRENLDDEIVQISKPYLEYSVSD |
| A0A2V8U5Y6 | 111-199 | None |
| A0A2V9CNW3 | 35-117 | None |
| B9XCP8 | 185-268 | None |
| A0A2V8ZPJ7 | 13-84 | None |
| A0A2V6CB74 | 2-84 | None |
| A0A2V9NZA0 | 45-121 | None |
| A0A2V9VBI0 | 1-68 | None |
| A0A6P2D2Q0 | 629-704 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.