DPCstruct | MC29389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 161 ± 18 aa |
| Standard deviation of domain lengths | 18.01 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8J2Y6 | 1-174 | MSVSFRDFQPINTWKLDSDGSKWDDGEAEHLIDTTTGRRYWNESKGCVGFKCFLLTLGTPIFHSIASLVNVAYRIVKLVSFSHFWMD… |
| A0A1F8J2U4 | 36-194 | NRPVSFSHFLPYTSFESGVDLSNGDQYWEDNPYITRLKCLGLVAATPILHAIGLVLNLANRIAKIVSFAHFWHSSSDHYSLSEKSWS… |
| A0A2E3LYQ1 | 1-152 | None |
| A0A655MX65 | 63-227 | None |
| A0A6M1ZRG3 | 105-239 | None |
| A0A1M3CP75 | 54-230 | None |
| D6YUA6 | 3-144 | None |
| A0A7W1RFG7 | 13-208 | None |
| A0A2H0VVM8 | 18-182 | None |
| A0A2E1K1D2 | 27-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.