DPCstruct | MC29385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 85 ± 17 aa |
| Standard deviation of domain lengths | 16.51 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 53.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K5NM21 | 1-84 | MDQEEGLKALDNIVTQFNTYEDFLDSQITTVDLYYLEDETLARQLVELGYRGTGERVKREDFEARKAAIEISRLAERAQQKFSS |
| A0A6A1Q3C4 | 1-84 | MDQEEGSTTVDNIVTQFNTYEDFLDSQITTLDMYYLEDEGLARQLVELGYRGTGEVVKREDFEARKAAIEIARLAERTQKNIDN |
| A0A556U836 | 240-311 | None |
| G5AWK6 | 1-103 | None |
| S9WEI5 | 1-77 | None |
| A0A2R6XQ23 | 22-139 | None |
| A0A4Z2I2N9 | 1-81 | None |
| A0A7E6EIU4 | 11-93 | None |
| A0A2C9JW84 | 13-86 | None |
| A0A811ZXR0 | 20-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.