DPCstruct | MC29383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 93 ± 4 aa |
| Standard deviation of domain lengths | 4.05 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 76.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.79 |
| Pfam Score | 89.29 |
| Assigned Pfam label(s) | CL0489- CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A643CJ73 | 4-99 | VNWARFPMEQSLVAVQCQGQIFYESCKELYQNPELLVWYGDCYEKFLDIPVSLQVIKQGNQASGPSEESAEGYRCERCGKVFTYEYY… |
| A0A4W5LTX0 | 1-92 | MWLRLVQSARDRDEQNLEAYVKNGQLLYRSLRRIEKDEELLVWYGKDLIELLLLSAGKAPVKAKGSTPYSCPDCNQRFQFEFPFLAH… |
| A0A7I8VAD7 | 343-431 | None |
| A0A3P4S065 | 1-96 | None |
| A0A1S3MSU9 | 154-249 | None |
| X1WIT3 | 43-125 | None |
| W5Q2Z7 | 20-114 | None |
| A0A3B3ZFV4 | 106-202 | None |
| A0A7E6DWU1 | 63-157 | None |
| A0A067QKA6 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.