DPCstruct | MC29381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 114 ± 17 aa |
| Standard deviation of domain lengths | 17.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 51.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16496 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q1DHY3 | 5-111 | LFAHRKKDSSPSARFWESPDTLAQLDVVRQWMGKHYKKYVLVDAPSCQALAAVTLQLLQFQEDAFGRQATSPALTKLPAQCYLDLRP… |
| A0A1S4EKR2 | 7-137 | KKDGSPNKQFFESSETVALFEGVRTWLLKNCKKYVQTDPPTNKSLASLVVQLIQFQEENFGKNVSKPPLTRLPMKCFLDFKPGGALC… |
| A0A6P7GRZ5 | 2-108 | None |
| A0A183K8Q2 | 7-128 | None |
| A0A1Y1XVZ5 | 1-172 | None |
| A0A3B4XCP6 | 11-111 | None |
| A0A1I8I236 | 1-108 | None |
| A0A1W2P6N7 | 12-112 | None |
| A0A7J7R2P3 | 22-133 | None |
| A0A1A9YRA8 | 38-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.