DPCstruct | MC29380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 434 ± 65 aa |
| Standard deviation of domain lengths | 64.68 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q1CHC7 | 1-371 | MAWKHLLLDKLHLPPPGSARSENYDLILEAYESFLKRSNAVDLVDIFSMYKQLGLEPEEPVSPTQLFEFLSGNMEIPELPSVPSTPS… |
| A0A060WGG0 | 1-434 | MENLEDRLKTMVRTFRRECHRVLESERTTIHGADGMLMVLQLAIAEVNKQESGEFSVALSDVLVAWKHLLLDKLHLPLDNDSSRPEN… |
| A0A7I8V670 | 66-493 | None |
| A0A6P8HXW7 | 70-598 | None |
| A0A2K6BRU4 | 5-381 | None |
| C3ZD30 | 93-581 | None |
| A0A0V0J6W0 | 26-492 | None |
| A0A6P7RBP0 | 6-360 | None |
| A0A6Q2ZMA8 | 1-516 | None |
| A0A6P7S4B6 | 56-538 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.