DPCstruct | MC2938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 147 ± 26 aa |
| Standard deviation of domain lengths | 25.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8LDS9 | 3-152 | RLNQWRFEQQYWERSRQDRIRLQSFSYYDYGDPIYRYSLNGSYYDVNQYGADLLQRAINDGYEEGFRAGQADRQDGWQYDPENCDAY… |
| A0A2V8Q4D2 | 19-168 | RQNYWRFHQNYYDRLRRDQIRLQSFNYYDYGAPTYYYDRGGSSFYLNQYGADLLTRAINDGYEEGYRAGLADRQDGWQFDPENNDAF… |
| A0A2V8SIM3 | 51-185 | None |
| A0A1Q6X495 | 82-254 | None |
| A0A7W0NR43 | 60-221 | None |
| A0A7V8Z6W1 | 103-189 | None |
| A0A7G9QTC9 | 281-450 | None |
| A0A1H0ZGH8 | 337-510 | None |
| A0A7W1H5U6 | 29-139 | None |
| A0A4Q6FD49 | 153-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.