DPCstruct | MC29372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 5.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 23.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14285 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R5KTH6 | 265-339 | LRVSYQKLHKNSALTVGSFMPETRTDVVVRGTKAVFSTTENQFVRLEWMEGNVFVSISGRELDESELIRMAEGLK |
| A0A1B6B801 | 75-147 | NDRIEFSQASIDANLQVDTEDASIEDIEINGMAGIFVEKEDLSILLWATDTDAFYILGTLDKETFLNIAENLE |
| A0A4Z0R5T3 | 13-88 | None |
| A0A644XYB1 | 1-85 | None |
| A0A7W0KJ13 | 150-215 | None |
| A0A6N7B0J4 | 1-69 | None |
| A0A2K2FD66 | 179-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.