DPCstruct | MC29371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 107 ± 14 aa |
| Standard deviation of domain lengths | 14.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A136MN87 | 1-91 | MKLCFLWHQHQPDYRWNGEFRLPWVQMHATKDYLDIPLLLSDYPVKHTFNLVPSLIDQLDSASQGMADPVSKLCMIHPQERTPSHEH… |
| A0A1W9PA77 | 35-139 | IDPMIYLFIVWHMHQPYYKNDREHTYLMPWVRLHAAKDYYDMLMIAREEEAKVSFNLTPVLLEQIEDYTRNNVKEIQNEMMLKDTSA… |
| B8DZW9 | 1-129 | None |
| A0A7C7DHA2 | 46-145 | None |
| H6Q9A8 | 21-152 | None |
| A0A7C3R3C7 | 1-105 | None |
| A0A7C5Y239 | 1-130 | None |
| A0A535ICK7 | 4-126 | None |
| A0A538SPD0 | 8-104 | None |
| A0A1Q7HAU5 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.