DPCstruct | MC29370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 70 ± 9 aa |
| Standard deviation of domain lengths | 9.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 65.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9NW53 | 3-84 | IDESHIAIPQIKGMYKADRTRKSILVRYGFRLSSCFENRPLKWEEFKGYMKKVIFMSATPGEYECKLSRIVEQLVRPTGRSG |
| A4NXJ1 | 39-102 | LIIDESHVTVPQIGGMYRGDRSRKETLVEYGFRLPSALDNRPLRFEEFERLAPQTIYVSATPGP |
| A0A0U1PTA5 | 1-64 | None |
| W1VQJ5 | 9-71 | None |
| W4VIV0 | 76-139 | None |
| A0A2X5PBE3 | 259-326 | None |
| A0A6G3V655 | 13-76 | None |
| A0A6D0LZJ4 | 35-120 | None |
| A0A378VY85 | 10-97 | None |
| A0A6M1I1J9 | 108-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.