DPCstruct | MC2937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 468 ± 49 aa |
| Standard deviation of domain lengths | 48.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4T643 | 2-474 | LQSNVEIKVYASFARLTCTATGGTLGQAGPNWIVNNFPGAKANTLYPSALGDAIAGQDLVPDPSDPADVFSQFNGDLGKDDCLAGSG… |
| A0A2V8LAB8 | 10-516 | LTVTAFAVAVLLSVSSKSFASATIVILNNDSAGVGFNDPTAVAPVGNNNGTTLGQQRLNAFQFAANVWGATLNSSVTITIRASWGHL… |
| A0A4U5JNJ7 | 222-737 | None |
| A0A2M7CXC9 | 2-471 | None |
| A0A5B7ZSG3 | 1-527 | None |
| A0A3E0NRI1 | 358-703 | None |
| A0A846V5N0 | 13-549 | None |
| A0A7Y2AY15 | 16-468 | None |
| A0A257LHX6 | 27-438 | None |
| A0A7Y1UKH7 | 3-454 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.