DPCstruct | MC29368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 212 ± 60 aa |
| Standard deviation of domain lengths | 59.77 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 77.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.05 |
| Pfam Score | 98.86 |
| Assigned Pfam label(s) | PF04502- CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L0CJU2 | 4-266 | RRSGGRYIDEQQQKLEAKQKKAFKNKLKDKGLTIKDLKYEFNKANKIRFMNPINLICESCQTYIPKNRKFNGYKREVNQAKEFDATY… |
| T0NJ58 | 180-363 | PPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQNEAYLGLPIFRFYIKCTRCLAEITFKTDPENTDY… |
| A0A6A2XRA6 | 2-109 | None |
| A0A4V1XXL9 | 10-258 | None |
| A0A6G1DW85 | 1-176 | None |
| A0A2P9C814 | 14-256 | None |
| A0A2G8S8M7 | 5-275 | None |
| M8CB64 | 49-290 | None |
| A0A2P5E710 | 2-118 | None |
| A0A5D2VQD8 | 3-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.