DPCstruct | MC29367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 143 ± 11 aa |
| Standard deviation of domain lengths | 11.49 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11603 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L8RIM1 | 4-155 | VLEGKMVVVDGWIVDLEEHKLVKPSRACRKKSKEHVTKLNSVPLVNWETLYDEKCALKNISNDELFKLIKCEKYEFAEMEDSSTQFV… |
| A0A7I9EY50 | 37-162 | SFVYIDGFLVKKHNNQHTIVNFETYKNKMKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIRTEVRSFYEDEKSGLIKVVK… |
| H2AYL2 | 3-150 | None |
| H0GXK5 | 1-124 | None |
| H0H0K6 | 1-136 | None |
| H0GQD4 | 53-213 | None |
| A0A1G4ITE8 | 7-137 | None |
| A0A6C1EGR2 | 1-136 | None |
| F7VJN8 | 1-140 | None |
| A0A1G4M8S9 | 1-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.