DPCstruct | MC29363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 78 ± 4 aa |
| Standard deviation of domain lengths | 3.83 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C8X610 | 46-126 | VKGTLKAGQLADFILLSADFFRVDDAQIADITSVLTVVGGRIVHADADYAGLAPQLPPAMPDWSPVNRFGGYNVGGAAPGL |
| A0A534VW04 | 484-560 | VKGRIAPGQYADFAVLSADYLAVPEEEIKQLESVLTVVGGDPVFAAGPYARLVATSLPPIKPEWSPVAFYGGYARKK |
| A0A2N3ZFV9 | 73-151 | None |
| A0A645C6S6 | 251-323 | None |
| A0A846BL96 | 48-131 | None |
| H1S849 | 313-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.