DPCstruct | MC29362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 163 ± 9 aa |
| Standard deviation of domain lengths | 8.73 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3VVW4 | 9-170 | LLCFISVSCVDNDDSDIKLDVPSQPELTDKTPVDSKIKKMYENYGCFIHYEFTKEEFTYDWSTHFSTPSYSPAKADKVVDVLDFIEE… |
| K1G0S9 | 11-165 | RYFFRRSLYLLVISFLLAGCEEEASLSARSVVEAGETERERTELDKWILDTFTRPYGIEVEYRWDKNAVQNGSYIYPPEVANVKSVL… |
| A0A496M467 | 1-171 | None |
| A0A6M1E4S4 | 6-168 | None |
| U2HCZ5 | 2-169 | None |
| H1Z521 | 1-175 | None |
| E4MU49 | 1-156 | None |
| A0A191TJB6 | 7-158 | None |
| A0A425XY59 | 20-174 | None |
| A0A844F1A0 | 1-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.