DPCstruct | MC29361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 208 ± 44 aa |
| Standard deviation of domain lengths | 44.26 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13708 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A126PA84 | 56-253 | RGSLRTSYNNFADEMNQQIWGLVLDKVNIQKLMTVDVRRNFAAFSKAQGYQEFTHEAVAELVALVLDNRETIMEQAVESVFDTFTKY… |
| A0A2W6NNP1 | 324-530 | ISHGAFHGVMSSYDYRDSLTRIKESFIRNICYYFINKYKVTIDHEKIINKLTFESGFQDVLDNIFVQLDGYSFTEKAEKEIKDNSKE… |
| A0A7J2RI07 | 3-229 | None |
| A0A362XI91 | 65-262 | None |
| E0LU30 | 6-178 | None |
| A0A608K4I9 | 24-184 | None |
| A0A6M6E098 | 270-502 | None |
| A0A7S9DNT6 | 3-122 | None |
| A0A7H2Y586 | 20-243 | None |
| A0A1E5BJT6 | 26-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.